Whois Lookup Dominio - IP argentcu.org
argentcu.org dominio lookup resultados del servidor whois.pir.org: Domain Name: argentcu.org Registry Domain ID: 5b5080ac5a48414d9bc32f6254898f3b-LROR Registrar WHOIS Server: whois.networksolutions.com Registrar URL: http://www.networksolutions.com Updated Date: 2023-04-27T05:52:51Z Creation Date: 2010-06-21T21:58:04Z Registry Expiry Date: 2026-06-21T21:58:04Z Registrar: Network Solutions, LLC Registrar IANA ID: 2 Registrar Abuse Contact Email: domain.operations@web.com Registrar Abuse Contact Phone: +1.9046806694 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: REDACTED Registrant Name: REDACTED Registrant Organization: Registrant Street: REDACTED Registrant City: REDACTED Registrant State/Province: FL Registrant Postal Code: REDACTED Registrant Country: US Registrant Phone: REDACTED Registrant Phone Ext: REDACTED Registrant Fax: REDACTED Registrant Fax Ext: REDACTED Registrant Email: REDACTED Registry Admin ID: REDACTED Admin Name: REDACTED Admin Organization: REDACTED Admin Street: REDACTED Admin City: REDACTED Admin State/Province: REDACTED Admin Postal Code: REDACTED Admin Country: REDACTED Admin Phone: REDACTED Admin Phone Ext: REDACTED Admin Fax: REDACTED Admin Fax Ext: REDACTED Admin Email: REDACTED Registry Tech ID: REDACTED Tech Name: REDACTED Tech Organization: REDACTED Tech Street: REDACTED Tech City: REDACTED Tech State/Province: REDACTED Tech Postal Code: REDACTED Tech Country: REDACTED Tech Phone: REDACTED Tech Phone Ext: REDACTED Tech Fax: REDACTED Tech Fax Ext: REDACTED Tech Email: REDACTED Name Server: arya.ns.cloudflare.com Name Server: ivan.ns.cloudflare.com DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://icann.org/wicf/ >>> Last update of WHOIS database: 2025-06-27T03:40:42Z <<< For more information on Whois status codes, please visit https://icann.org/epp Terms of Use: Access to Public Interest Registry WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Public Interest Registry registry database. The data in this record is provided by Public Interest Registry for informational purposes only, and Public Interest Registry does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Identity Digital except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Public Interest Registry reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy. The Registrar of Record identified in this output may have an RDDS service that can be queried for additional information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Ver Registros DNS de argentcu.org
Últimas 5 consultas: anettesmassagefriskvardspraktik.com | casadosengenheiros.com.br | 251.130.213.28 | caratncents.com | 79.118.33.174 |